Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g089040.1.1
Common NameLAT61
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family BES1
Protein Properties Length: 334aa    MW: 35772.9 Da    PI: 8.8759
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g089040.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         gg++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+  +e++g+s++++p+
                         689*************************************************************************.************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasaasll 137
                         ss + s+ ss++asp++sy++sp+sssfpsps++d ++++++ s+l
                         ************************************9887653333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.9E-6337166IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.34970.0callus| fruit| leaf| trichome
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3959010.0Lycopersicon esculentum mature anther-specific protein LAT61 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234745.20.0mature anther-specific protein LAT61
TrEMBLK4DGX50.0K4DGX5_SOLLC; Uncharacterized protein
STRINGSolyc12g089040.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37191024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-99BES1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84